HPA012297

TNIK antibody from Sigma-Aldrich
KIAA0551
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012297
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012297, RRID:AB_1858225
Product name
Anti-TNIK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012297
Antibody type
Polyclonal
Antigen
TRAF2 and NCK-interacting protein kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AKELRELRIEETNRPMKKVTDYSSSSEESESSEEE
EEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNV
GMVGTHGLETSHADSFSGSISREGTLMIRETSGEK
KRSGHSDSNGFAGHINLPDLV
Storage
-20C
Provider Type Product Number
- No reagents -