Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA012128 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012128, RRID:AB_1858226
- Product name
- Anti-TNIK
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEM
PRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPP
KVPQRTTSISPALARKNSPGNGSALGPRLGSQPIR
ASNPDLRRTEPILESPLQRTSSGSSSSSS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Prognostic significance of Traf2- and Nck- interacting kinase (TNIK) in colorectal cancer.
The essential role of TNIK gene amplification in gastric cancer growth.
Takahashi H, Ishikawa T, Ishiguro M, Okazaki S, Mogushi K, Kobayashi H, Iida S, Mizushima H, Tanaka H, Uetake H, Sugihara K
BMC cancer 2015 Oct 24;15:794
BMC cancer 2015 Oct 24;15:794
The essential role of TNIK gene amplification in gastric cancer growth.
Yu DH, Zhang X, Wang H, Zhang L, Chen H, Hu M, Dong Z, Zhu G, Qian Z, Fan J, Su X, Xu Y, Zheng L, Dong H, Yin X, Ji Q, Ji J
Oncogenesis 2014 Feb 24;2(2):e89
Oncogenesis 2014 Feb 24;2(2):e89
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of colon shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human upper gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows very weak cytoplasmic positivity in a small subset of squamous epithelial cells.
- Sample type
- HUMAN