HPA012128

TNIK antibody from Atlas Antibodies
KIAA0551
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012128
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012128, RRID:AB_1858226
Product name
Anti-TNIK
Provider product page
Atlas Antibodies - HPA012128
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEM
PRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPP
KVPQRTTSISPALARKNSPGNGSALGPRLGSQPIR
ASNPDLRRTEPILESPLQRTSSGSSSSSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -