HPA007053

antibody from Atlas Antibodies

Targeting: CDK19 bA346C16.3, CDC2L6, CDK11, KIAA1028

No application information provided.

Antibody Data

Product number

HPA007053

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#HPA007053, RRID:AB_1233803

Product name

Anti-CDK19

Antibody type

Polyclonal

Description

Affinity purified using the PrEST antigen as affinity ligand

Reactivity

Human, Mouse, Rat

Host

Rabbit

Conjugate

Unconjugated

Antigen sequence

KGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQN
STQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPP
NKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSV
QGSSQSQSTLGYSSSSQQSSQYHPSH


Isotype

IgG

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References

Submitted references

Wood K, Nussbaum D, Martz C, Waters A, Barrera A, Rutter J, Cerda-Smith C, Stewart A, Wu C, Cakir M, Levandowski C, Kantrowitz D, McCall S, Pierobon M, III E, Smith J, Der C, Taatjes D
2023

---

CDK8 and CDK19 act redundantly to control the CFTR pathway in the intestinal epithelium

Prieto S, Dubra G, Camasses A, Aznar A, Begon‐Pescia C, Simboeck E, Pirot N, Gerbe F, Angevin L, Jay P, Krasinska L, Fisher D
EMBO reports 2022;24(2)

---

CDK19 as a Potential HPV-Independent Biomarker for Recurrent Disease in HNSCC

Paulsen F, Idel C, Ribbat-Idel J, Kuppler P, Klapper L, Rades D, Bruchhage K, Wollenberg B, Brägelmann J, Perner S, Offermann A
International Journal of Molecular Sciences 2020;21(15):5508

---

Characterizing CDK8/19 Inhibitors through a NFκB-Dependent Cell-Based Assay

Li J, Ji H, Porter D, Broude E, Roninson I, Chen M
Cells 2019;8(10):1208

---

Transcriptional Responses to IFN-γ Require Mediator Kinase-Dependent Pause Release and Mechanistically Distinct CDK8 and CDK19 Functions

Steinparzer I, Sedlyarov V, Rubin J, Eislmayr K, Galbraith M, Levandowski C, Vcelkova T, Sneezum L, Wascher F, Amman F, Kleinova R, Bender H, Andrysik Z, Espinosa J, Superti-Furga G, Dowell R, Taatjes D, Kovarik P
Molecular Cell 2019;76(3):485-499.e8

---

Didehydro-Cortistatin A Inhibits HIV-1 by Specifically Binding to the Unstructured Basic Region of Tat

Mediouni S, Chinthalapudi K, Ekka M, Usui I, Jablonski J, Clementz M, Mousseau G, Nowak J, Macherla V, Beverage J, Esquenazi E, Baran P, de Vera I, Kojetin D, Loret E, Nettles K, Maiti S, Izard T, Valente S, Harrich D, Prasad V
mBio 2019;10(1)

---

CDK8/19 inhibition induces premature G1/S transition and ATR-dependent cell death in prostate cancer cells

Nakamura A, Nakata D, Kakoi Y, Kunitomo M, Murai S, Ebara S, Hata A, Hara T
Oncotarget 2018;9(17):13474-13487

---

Oncogenic exon 2 mutations in Mediator subunit MED12 disrupt allosteric activation of cyclin C-CDK8/19

Park M, Shen H, Spaeth J, Tolvanen J, Failor C, Knudtson J, McLaughlin J, Halder S, Yang Q, Bulun S, Al-Hendy A, Schenken R, Aaltonen L, Boyer T
Journal of Biological Chemistry 2018;293(13):4870-4882

---

Inhibition of CDK8 mediator kinase suppresses estrogen dependent transcription and the growth of estrogen receptor positive breast cancer

McDermott M, Chumanevich A, Lim C, Liang J, Chen M, Altilia S, Oliver D, Rae J, Shtutman M, Kiaris H, Győrffy B, Roninson I, Broude E
Oncotarget 2017;8(8):12558-12575

---

Cyclin C regulates adipogenesis by stimulating transcriptional activity of CCAAT/enhancer-binding protein α

Song Z, Xiaoli A, Zhang Q, Zhang Y, Yang E, Wang S, Chang R, Zhang Z, Yang G, Strich R, Pessin J, Yang F
Journal of Biological Chemistry 2017;292(21):8918-8932

---

Mediator Kinase Phosphorylation of STAT1 S727 Promotes Growth of Neoplasms With JAK-STAT Activation

Nitulescu I, Meyer S, Wen Q, Crispino J, Lemieux M, Levine R, Pelish H, Shair M
EBioMedicine 2017;26

---

CDK8/19 Mediator kinases potentiate induction of transcription by NFκB

Chen M, Liang J, Ji H, Yang Z, Altilia S, Hu B, Schronce A, McDermott M, Schools G, Lim C, Oliver D, Shtutman M, Lu T, Stark G, Porter D, Broude E, Roninson I
Proceedings of the National Academy of Sciences 2017;114(38):10208-10213

---

Assessing the mechanism and therapeutic potential of modulators of the human Mediator complex-associated protein kinases

Clarke P, Ortiz-Ruiz M, TePoele R, Adeniji-Popoola O, Box G, Court W, Czasch S, El Bawab S, Esdar C, Ewan K, Gowan S, De Haven Brandon A, Hewitt P, Hobbs S, Kaufmann W, Mallinger A, Raynaud F, Roe T, Rohdich F, Schiemann K, Simon S, Schneider R, Valenti M, Weigt S, Blagg J, Blaukat A, Dale T, Eccles S, Hecht S, Urbahns K, Workman P, Wienke D
eLife 2016;5

---

Mediator kinase inhibition further activates super-enhancer-associated genes in AML

Pelish H, Liau B, Nitulescu I, Tangpeerachaikul A, Poss Z, Da Silva D, Caruso B, Arefolov A, Fadeyi O, Christie A, Du K, Banka D, Schneider E, Jestel A, Zou G, Si C, Ebmeier C, Bronson R, Krivtsov A, Myers A, Kohl N, Kung A, Armstrong S, Lemieux M, Taatjes D, Shair M
Nature 2015;526(7572):273-276

---

Cyclin C is a haploinsufficient tumour suppressor

Li N, Fassl A, Chick J, Inuzuka H, Li X, Mansour M, Liu L, Wang H, King B, Shaik S, Gutierrez A, Ordureau A, Otto T, Kreslavsky T, Baitsch L, Bury L, Meyer C, Ke N, Mulry K, Kluk M, Roy M, Kim S, Zhang X, Geng Y, Zagozdzon A, Jenkinson S, Gale R, Linch D, Zhao J, Mullighan C, Harper J, Aster J, Aifantis I, von Boehmer H, Gygi S, Wei W, Look A, Sicinski P
Nature Cell Biology 2014;16(11):1080-1091

---

Mediator Complex Recruits Epigenetic Regulators via Its Two Cyclin-dependent Kinase Subunits to Repress Transcription of Immune Response Genes

Tsutsui T, Fukasawa R, Shinmyouzu K, Nakagawa R, Tobe K, Tanaka A, Ohkuma Y
Journal of Biological Chemistry 2013;288(29):20955-20965