H00057551-M01
antibody from Abnova Corporation
Targeting: TAOK1
FLJ14314, KIAA1361, MAP3K16, MARKK, PSK2, TAO1
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057551-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057551-M01, RRID:AB_607142
- Product name
- TAOK1 monoclonal antibody (M01), clone 4E12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TAOK1.
- Antigen sequence
LSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPM
GGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMG
VRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGS
HMSYT- Isotype
- IgG
- Antibody clone number
- 4E12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TAOK1 monoclonal antibody (M01), clone 4E12 Western Blot analysis of TAOK1 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TAOK1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TAOK1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol