HPA007669

TAOK1 antibody from Sigma-Aldrich
FLJ14314, KIAA1361, MAP3K16, MARKK, PSK2, TAO1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007669
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007669, RRID:AB_1080201
Product name
Anti-TAOK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007669
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase TAO1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGP
PQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRN
SPQALRRTASGGRTEQGMSRSTSVTSQISNGSH
Storage
-20C
Provider Type Product Number
- No reagents -