HPA024016

FAM205A antibody from MilliporeSigma / Merck KGaA
C9orf144B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024016
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA024016, RRID:AB_1853040
Product name
Anti-AL162231.20-2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA024016
Antibody type
Polyclonal
Antigen
Transmembrane protein C9orf144B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AATSQSVITEMEPSPVEIPAEPLIQMVSFEEQCIS
LGPCPQGNNESCTDVAKEFQPAVPVKGTMETLPLE
SQTHPTSPHSLQTHILTKLNFHLRKKVLEIQWGIP
IRARKSREQTVAAP
Storage
-20C
Provider Type Product Number
- No reagents -