HPA006181

MRPL40 antibody from Atlas Antibodies
MRP-L22, NLVCF
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006181
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006181, RRID:AB_1079411
Product name
Anti-MRPL40
Provider product page
Atlas Antibodies - HPA006181
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TQLRETQELIPIEDFITPLKFLDKARERPQVELTF
EETERRALLLKKWSLYKQQERKMERDTIRAMLEAQ
QEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHY
TPPIPNYQPPEGRYNDITK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -