HPA006181

MRPL40 antibody from Sigma-Aldrich
MRP-L22, NLVCF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006181
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006181, RRID:AB_1079411
Product name
Anti-MRPL40 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006181
Antibody type
Polyclonal
Antigen
39S ribosomal protein L40, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQLRETQELIPIEDFITPLKFLDKARERPQVELTF
EETERRALLLKKWSLYKQQERKMERDTIRAMLEAQ
QEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHY
TPPIPNYQPPEGRYNDITK
Storage
-20C
Provider Type Product Number
- No reagents -