HPA008958

NUAK2 antibody from Sigma-Aldrich
FLJ90349, SNARK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008958
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008958, RRID:AB_1080040
Product name
Anti-NUAK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008958
Antibody type
Polyclonal
Antigen
NUAK family SNF1-like kinase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELA
APTTFGSLDELAPPRPLARASRPSGAVSEDSILSS
ESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSE
GPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQAL
RVCSKLT
Storage
-20C
Provider Type Product Number
- No reagents -