H00079012-B01P

CAMKV antibody from Abnova Corporation
MGC8407, VACAMKL

Antibody data

Product number
H00079012-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079012-B01P, RRID:AB_1572064
Product name
CAMKV purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00079012-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CAMKV protein.
Antigen sequence
MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEF
CEIFRAKDKTTGKLHTCKKFQKRDGRKVRKAAKNE
IGILKMVKHPNILQLVDVFVTRKEYFIFLELATGR
EVFDWILDQGYYSERDTSNVVRQVLEAVAYLHSLK
IVHRNLKLENLVYYNRLKNSKIVISDFHLAKLENG
LIKEPCGTPEYLAPEVVGRQRYGRPVDCWAIGVIM
YILLSGNPPFYEEVEEDDYENHDKNLFRKILAGDY
EFDSPYWDDISQAAKDLVTRLMEVEQDQRITAEEA
ISHEWISGNAASDKNIKDGVCAQIEKNFARAKWKK
AVRVTTLMKRLRAPEQSSTAAAQSASATDTATPGA
AGGATAAAASGATSAPEGDAARAAKSDNVAPADRS
ATPATDGSATPATDGSVTPATDGSITPATDGSVTP
ATDRSATPATDGRATPATEESTVPTTQSSAMLATK
AAATPEPAMAQPDSTAPEGATGQAPPSSKGEEAAG
YAQESQREEAS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -