HPA007656

CAMKV antibody from Sigma-Aldrich
MGC8407, VACAMKL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007656
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007656, RRID:AB_1078391
Product name
Anti-CAMKV antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007656
Antibody type
Polyclonal
Antigen
CaM kinase-like vesicle-associated protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEF
DSPYWDDISQAAKDLVTRLMEVEQDQRITAEEAIS
HEWISGNAASDKNIKDGVCAQIEKNFARAKW
Storage
-20C
Provider Type Product Number
- No reagents -