HPA012057

PHKG1 antibody from Sigma-Aldrich
PHKG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012057
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012057, RRID:AB_1855305
Product name
Anti-PHKG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012057
Antibody type
Polyclonal
Antigen
Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQ
EYAVKVIDVTGGGSFSPEEVRELREATLKEVDILR
KVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFD
YLTEKVTLSEKETRKIMR
Storage
-20C
Provider Type Product Number
- No reagents -