HPA012057

PHKG1 antibody from Atlas Antibodies
PHKG
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012057
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012057, RRID:AB_1855305
Product name
Anti-PHKG1
Provider product page
Atlas Antibodies - HPA012057
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQ
EYAVKVIDVTGGGSFSPEEVRELREATLKEVDILR
KVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFD
YLTEKVTLSEKETRKIMR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -