Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502726 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MELK antibody: synthetic peptide directed towards the middle region of human MELK
- Description
- Affinity Purified
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
AVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTT
PSKAR NQCLKETPIK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Maternal embryonic leucine zipper kinase transcript abundance correlates with malignancy grade in human astrocytomas.
Marie SK, Okamoto OK, Uno M, Hasegawa AP, Oba-Shinjo SM, Cohen T, Camargo AA, Kosoy A, Carlotti CG Jr, Toledo S, Moreira-Filho CA, Zago MA, Simpson AJ, Caballero OL
International journal of cancer. Journal international du cancer 2008 Feb 15;122(4):807-15
International journal of cancer. Journal international du cancer 2008 Feb 15;122(4):807-15
No comments: Submit comment
No validations: Submit validation data