Antibody data

Product number
ABIN502726
Provider
antibodies-online
Product name
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (Middle Region) antibody
Provider product page
antibodies-online - ABIN502726
Antibody type
Polyclonal
Antigen
The immunogen for anti-MELK antibody: synthetic peptide directed towards the middle region of human MELK
Description
Affinity Purified
Reactivity
Human, Bovine, Canine
Host
Rabbit
Antigen sequence
AVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTT
PSKAR NQCLKETPIK
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -