HPA017214

MELK antibody from Sigma-Aldrich
KIAA0175
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017214
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017214, RRID:AB_1853798
Product name
Anti-MELK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017214
Antibody type
Polyclonal
Antigen
Maternal embryonic leucine zipper kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLST
GAATPRTSQFTKYWTESNGVESKSLTPALCRTPAN
KLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQH
KREILTTPNRYTTPSKARNQCLKETPIKIPVNSTG
TD
Storage
-20C
Provider Type Product Number
- No reagents -