WH0051755M2

CDK12 antibody from Sigma-Aldrich
CRK7, CRKR, CRKRS, KIAA0904
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
WH0051755M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0051755M2, RRID:AB_1840970
Product name
Monoclonal Anti-CRKRS antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0051755M2
Antibody type
Monoclonal
Antigen
CRKRS (NP_057591, a.a. 1281-1380) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGH
LPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSA
IDTDERNSGPALTESLVQTLVKNRTFSGSL (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -