Antibody data

Product number
H00051755-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051755-M02, RRID:AB_534826
Product name
CRKRS monoclonal antibody (M02), clone 2F6
Provider product page
Abnova Corporation - H00051755-M02
Antibody type
Monoclonal
Antigen
CRKRS (NP_057591, 1281 a.a. ~ 1380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
Mouse monoclonal antibody raised against a partial recombinant CRKRS.
Reactivity
Human
Host
Mouse
Antigen sequence
LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGH
LPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSA
IDTDERNSGPALTESLVQTLVKNRTFSGSL
Isotype
IgG
Vial size
50 μg
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -