H00051755-M01

CDK12 antibody from Abnova Corporation
CRK7, CRKR, CRKRS, KIAA0904

Antibody data

Product number
H00051755-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051755-M01, RRID:AB_565608
Product name
CRKRS monoclonal antibody (M01), clone 1H4
Provider product page
Abnova Corporation - H00051755-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CRKRS.
Antigen sequence
LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGH
LPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSA
IDTDERNSGPALTESLVQTLVKNRTFSGSL
Isotype
IgG
Antibody clone number
1H4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -