HPA008038

CDK12 antibody from MilliporeSigma / Merck KGaA
CRK7, CRKR, CRKRS, KIAA0904
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008038
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA008038, RRID:AB_1078570
Product name
Anti-CRKRS antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA008038
Antibody type
Polyclonal
Antigen
Cell division cycle 2-related protein kinase 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GFSAIDTDERNSGPALTESLVQTLVKNRTFSGSLS
HLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVV
GQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGAS
SSGAGLHWGGPTQSSAY
Storage
-20C
Provider Type Product Number
- No reagents -