HPA010535

MLKL antibody from Sigma-Aldrich
FLJ34389
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010535
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010535, RRID:AB_1853988
Product name
Anti-MLKL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010535
Antibody type
Polyclonal
Antigen
Mixed lineage kinase domain-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGS
IAIVRQTFNKEIKTMKKFESPNILRIFGICIDETV
TPPQFSIVMEYCELGTLRELLDREKDLTLGKRMVL
VLGAARGLYRLHHSEAPELHGKIRSSNFLVTQ
Storage
-20C
Provider Type Product Number
- No reagents -