Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182787 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Somatostatin Receptor 4 (SSTR4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SSTR4 antibody: synthetic peptide directed towards the middle region of human SSTR4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Porcine
- Host
- Rabbit
- Antigen sequence
AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVA
CNLQW PHPAWSAVFV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Somatostatin receptor genes are expressed in lymphocytes from retroorbital tissues in Graves' disease.
Somatostatin receptor genes are expressed in lymphocytes from retroorbital tissues in Graves' disease.
Pasquali D, Notaro A, Bonavolonta' G, Vassallo P, Bellastella A, Sinisi AA
The Journal of clinical endocrinology and metabolism 2002 Nov;87(11):5125-9
The Journal of clinical endocrinology and metabolism 2002 Nov;87(11):5125-9
Somatostatin receptor genes are expressed in lymphocytes from retroorbital tissues in Graves' disease.
Pasquali D, Notaro A, Bonavolonta' G, Vassallo P, Bellastella A, Sinisi AA
The Journal of clinical endocrinology and metabolism 2002 Nov;87(11):5125-9
The Journal of clinical endocrinology and metabolism 2002 Nov;87(11):5125-9
No comments: Submit comment
No validations: Submit validation data