HPA012813

ANKK1 antibody from Sigma-Aldrich
X-kinase
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012813
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012813, RRID:AB_1844832
Product name
Anti-ANKK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012813
Antibody type
Polyclonal
Antigen
Ankyrin repeat and protein kinase domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRD
EELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDV
DCQTASGYTPLLIAAQDQQPDLCALLLAHGADANR
VDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQE
R
Storage
-20C
Provider Type Product Number
- No reagents -