Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000846 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-KIAA0586
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RLREVVSQNHGDHLVLLKDELPCVPPALSANKRLP
VGTGTSLNGTSRGSSDLTSARNCYQPLLENPMVSE
SDFSKDVAVQVLPLDKIEENNKQKANDIFISQYTM
GQKDALRTVLKQKAQSMPVFKEVKVHLLEDAGIEK
DAVTQE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references TALPID3 controls centrosome and cell polarity and the human ortholog KIAA0586 is mutated in Joubert syndrome (JBTS23).
Stephen LA, Tawamie H, Davis GM, Tebbe L, Nürnberg P, Nürnberg G, Thiele H, Thoenes M, Boltshauser E, Uebe S, Rompel O, Reis A, Ekici AB, McTeir L, Fraser AM, Hall EA, Mill P, Daudet N, Cross C, Wolfrum U, Jamra RA, Davey MG, Bolz HJ
eLife 2015 Sep 19;4
eLife 2015 Sep 19;4
No comments: Submit comment
No validations: Submit validation data