HPA000846

KIAA0586 antibody from Sigma-Aldrich
JBTS23, Talpid3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000846
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000846, RRID:AB_2234167
Product name
Anti-KIAA0586 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000846
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA0586 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLREVVSQNHGDHLVLLKDELPCVPPALSANKRLP
VGTGTSLNGTSRGSSDLTSARNCYQPLLENPMVSE
SDFSKDVAVQVLPLDKIEENNKQKANDIFISQYTM
GQKDALRTVLKQKAQSMPVFKEVKVHLLEDAGIEK
DAVTQE
Storage
-20C
Provider Type Product Number
- No reagents -