H00112858-M06

TP53RK antibody from Abnova Corporation
BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk

Antibody data

Product number
H00112858-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00112858-M06, RRID:AB_463896
Product name
TP53RK monoclonal antibody (M06), clone 2E8
Provider product page
Abnova Corporation - H00112858-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TP53RK.
Antigen sequence
HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSF
ISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLK
SYSTSSKKARPVLKKLDEVRLRGRKRSMVG
Isotype
IgG
Antibody clone number
2E8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -