HPA015837

TP53RK antibody from Sigma-Aldrich
BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015837
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015837, RRID:AB_1855776
Product name
Anti-TP53RK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015837
Antibody type
Polyclonal
Antigen
TP53-regulating kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AAVIKHRFPKGYRHPALEARLGRRRTVQEARALLR
CRRAGISAPVVFFVDYASNCLYMEEIEGSVTVRDY
IQSTMETEKTPQGLSNLAKTIGQV
Storage
-20C
Provider Type Product Number
- No reagents -