HPA015837

TP53RK antibody from Atlas Antibodies
BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk, TPRKB

Antibody data

Product number
HPA015837
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015837, RRID:AB_1855776
Product name
Anti-TP53RK
Provider product page
Atlas Antibodies - HPA015837
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AAVIKHRFPKGYRHPALEARLGRRRTVQEARALLR
CRRAGISAPVVFFVDYASNCLYMEEIEGSVTVRDY
IQSTMETEKTPQGLSNLAKTIGQV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.