HPA025068

C8orf48 antibody from MilliporeSigma / Merck KGaA
FLJ25402
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025068
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA025068, RRID:AB_1845781
Product name
Anti-C8orf48 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA025068
Antibody type
Polyclonal
Antigen
Uncharacterized protein C8orf48 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KWINYLKLKDSNFERHQPDTKLPTEITRVSDEELN
ALQSYCTMKINLIHRRGDSKKKTSSRHKKLHLGLD
V
Storage
-20C
Provider Type Product Number
- No reagents -