Antibody data

Product number
H00009943-M16
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009943-M16, RRID:AB_581596
Product name
OXSR1 monoclonal antibody (M16), clone 3A8
Provider product page
Abnova Corporation - H00009943-M16
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant OXSR1.
Antigen sequence
MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAY
CAPKKEKVAIKRINLEKCQTSMDELLKEIQAMSQC
HHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIK
HIVAKGEHKSGVLDESTIATILREVLEGLEYLHKN
GQIHRDVKAGNILLGEDGSVQIADFGVSAFLATGG
DITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADI
WSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPP
SLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRP
TAAELLRHKFFQKAKNKEFLQEKTLQRAPTISERA
KKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEG
KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVP
EQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQA
LSSGSGSQETKIPISLVLRLRNSKKELNDIRFEFT
PGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIV
EEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLS
IS
Isotype
IgG
Antibody clone number
3A8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -