Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009943-M09 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009943-M09, RRID:AB_490103
- Product name
- OXSR1 monoclonal antibody (M09), clone 5D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant OXSR1.
- Antigen sequence
KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVP
EQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQA
LSSGSGSQETKIPISLVLRLRNSKKELNDI- Isotype
- IgG
- Antibody clone number
- 5D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Impaired KLHL3-mediated ubiquitination of WNK4 causes human hypertension.
Common noncoding UMOD gene variants induce salt-sensitive hypertension and kidney damage by increasing uromodulin expression.
WNK-OSR1/SPAK-NCC signal cascade has circadian rhythm dependent on aldosterone.
Effect of heterozygous deletion of WNK1 on the WNK-OSR1/ SPAK-NCC/NKCC1/NKCC2 signal cascade in the kidney and blood vessels.
Phenotypes of pseudohypoaldosteronism type II caused by the WNK4 D561A missense mutation are dependent on the WNK-OSR1/SPAK kinase cascade.
Wakabayashi M, Mori T, Isobe K, Sohara E, Susa K, Araki Y, Chiga M, Kikuchi E, Nomura N, Mori Y, Matsuo H, Murata T, Nomura S, Asano T, Kawaguchi H, Nonoyama S, Rai T, Sasaki S, Uchida S
Cell reports 2013 Mar 28;3(3):858-68
Cell reports 2013 Mar 28;3(3):858-68
Common noncoding UMOD gene variants induce salt-sensitive hypertension and kidney damage by increasing uromodulin expression.
Trudu M, Janas S, Lanzani C, Debaix H, Schaeffer C, Ikehata M, Citterio L, Demaretz S, Trevisani F, Ristagno G, Glaudemans B, Laghmani K, Dell'Antonio G, SKIPOGH team, Loffing J, Rastaldi MP, Manunta P, Devuyst O, Rampoldi L
Nature medicine 2013 Dec;19(12):1655-60
Nature medicine 2013 Dec;19(12):1655-60
WNK-OSR1/SPAK-NCC signal cascade has circadian rhythm dependent on aldosterone.
Susa K, Sohara E, Isobe K, Chiga M, Rai T, Sasaki S, Uchida S
Biochemical and biophysical research communications 2012 Nov 2;427(4):743-7
Biochemical and biophysical research communications 2012 Nov 2;427(4):743-7
Effect of heterozygous deletion of WNK1 on the WNK-OSR1/ SPAK-NCC/NKCC1/NKCC2 signal cascade in the kidney and blood vessels.
Susa K, Kita S, Iwamoto T, Yang SS, Lin SH, Ohta A, Sohara E, Rai T, Sasaki S, Alessi DR, Uchida S
Clinical and experimental nephrology 2012 Aug;16(4):530-8
Clinical and experimental nephrology 2012 Aug;16(4):530-8
Phenotypes of pseudohypoaldosteronism type II caused by the WNK4 D561A missense mutation are dependent on the WNK-OSR1/SPAK kinase cascade.
Chiga M, Rafiqi FH, Alessi DR, Sohara E, Ohta A, Rai T, Sasaki S, Uchida S
Journal of cell science 2011 May 1;124(Pt 9):1391-5
Journal of cell science 2011 May 1;124(Pt 9):1391-5
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- OXSR1 monoclonal antibody (M09), clone 5D5 Western Blot analysis of OXSR1 expression in HeLa ( Cat # L013V1 ).