Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009943-M10 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009943-M10, RRID:AB_490104
- Product name
- OXSR1 monoclonal antibody (M10), clone 3F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant OXSR1.
- Antigen sequence
KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVP
EQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQA
LSSGSGSQETKIPISLVLRLRNSKKELNDI- Isotype
- IgG
- Antibody clone number
- 3F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Impaired degradation of WNK1 and WNK4 kinases causes PHAII in mutant KLHL3 knock-in mice.
Susa K, Sohara E, Rai T, Zeniya M, Mori Y, Mori T, Chiga M, Nomura N, Nishida H, Takahashi D, Isobe K, Inoue Y, Takeishi K, Takeda N, Sasaki S, Uchida S
Human molecular genetics 2014 Oct 1;23(19):5052-60
Human molecular genetics 2014 Oct 1;23(19):5052-60
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- OXSR1 monoclonal antibody (M10), clone 3F6 Western Blot analysis of OXSR1 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged OXSR1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
