HPA011388

MAP3K19 antibody from MilliporeSigma / Merck KGaA
FLJ23074, RCK, YSK4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011388
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA011388, RRID:AB_1848822
Product name
Anti-YSK4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA011388
Antibody type
Polyclonal
Antigen
SPS1/STE20-related protein kinase YSK4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAY
LHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRL
AWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGR
Storage
-20C
Provider Type Product Number
- No reagents -