HPA009073

AATK antibody from Sigma-Aldrich
AATYK, AATYK1, KIAA0641, LMR1, LMTK1, PPP1R77
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009073
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009073, RRID:AB_1078076
Product name
Anti-AATK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009073
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase LMTK1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSGIFTDTSSDGLQARRPDVVPAFRSLQKQVGTPD
SLDSLDIPSSASDGGYEVFSPSATGPSGGQPRALD
SGYDTENYESPEFVLKEAQEGCEPQAFAELASEGE
GPGPETRLSTSLSGLNEKNPYRDSA
Storage
-20C
Provider Type Product Number
- No reagents -