Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002049-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002049-M01, RRID:AB_530034
- Product name
- EPHB3 monoclonal antibody (M01), clone 1B3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EPHB3.
- Antigen sequence
AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDW
LDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRI
GVTLAGHQKKILSSIQDMRLQMNQTLPVQ- Isotype
- IgG
- Antibody clone number
- 1B3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The simultaneous expression of both ephrin B3 receptor and E-cadherin in Barrett`s adenocarcinoma is associated with favorable clinical staging.
Complementary expression of EphB receptors and ephrin-B ligand in the pyloric and duodenal epithelium of adult mice.
Class I and III HDACs and loss of active chromatin features contribute to epigenetic silencing of CDX1 and EPHB tumor suppressor genes in colorectal cancer.
Complementary expression and repulsive signaling suggest that EphB receptors and ephrin-B ligands control cell positioning in the gastric epithelium.
Microarray-based response prediction in esophageal adenocarcinoma.
Schauer MC, Stoecklein NH, Theisen J, Kröpil F, Baldus S, Hoelscher A, Feith M, Bölke E, Matuschek C, Budach W, Knoefel WT
European journal of medical research 2012 May 14;17:10
European journal of medical research 2012 May 14;17:10
Complementary expression of EphB receptors and ephrin-B ligand in the pyloric and duodenal epithelium of adult mice.
Ishii M, Nakajima T, Ogawa K
Histochemistry and cell biology 2011 Sep;136(3):345-56
Histochemistry and cell biology 2011 Sep;136(3):345-56
Class I and III HDACs and loss of active chromatin features contribute to epigenetic silencing of CDX1 and EPHB tumor suppressor genes in colorectal cancer.
Rönsch K, Jäger M, Schöpflin A, Danciu M, Lassmann S, Hecht A
Epigenetics 2011 May;6(5):610-22
Epigenetics 2011 May;6(5):610-22
Complementary expression and repulsive signaling suggest that EphB receptors and ephrin-B ligands control cell positioning in the gastric epithelium.
Ogawa K, Takemoto N, Ishii M, Pasquale EB, Nakajima T
Histochemistry and cell biology 2011 Dec;136(6):617-36
Histochemistry and cell biology 2011 Dec;136(6):617-36
Microarray-based response prediction in esophageal adenocarcinoma.
Schauer M, Janssen KP, Rimkus C, Raggi M, Feith M, Friess H, Theisen J
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 Jan 1;16(1):330-7
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 Jan 1;16(1):330-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EPHB3 monoclonal antibody (M01), clone 1B3 Western Blot analysis of EPHB3 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of EPHB3 expression in transfected 293T cell line by EPHB3 monoclonal antibody (M01), clone 1B3.Lane 1: EPHB3 transfected lysate(110.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EPHB3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to EPHB3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol