HPA007698

EPHB3 antibody from Sigma-Aldrich
ETK2, Hek2, Tyro6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007698
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007698, RRID:AB_1848205
Product name
Anti-EPHB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007698
Antibody type
Polyclonal
Antigen
Ephrin type-B receptor 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AHTRYTFEVQAVNGVSGKSPLPPRYAAVNITTNQA
APSEVPTLRLHSSSGSSLTLSWAPPERPNGVILDY
EMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVV
QVRARTVAGYGQYSRPAEFETTSE
Storage
-20C
Provider Type Product Number
- No reagents -