H00120892-M01
antibody from Abnova Corporation
Targeting: LRRK2
DKFZp434H2111, FLJ45829, PARK8, RIPK7, ROCO2
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00120892-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00120892-M01, RRID:AB_606543
- Product name
- LRRK2 monoclonal antibody (M01), clone 3B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LRRK2.
- Antigen sequence
NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVA
DSRILCLALVHLPVEKESWIVSGTQSGTLLVINTE
DGKKRHTLEKMTDSVTCLYCNSFSKQSKQK- Isotype
- IgG
- Antibody clone number
- 3B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references LRRK2 regulates autophagic activity and localizes to specific membrane microdomains in a novel human genomic reporter cellular model.
Alegre-Abarrategui J, Christian H, Lufino MM, Mutihac R, Venda LL, Ansorge O, Wade-Martins R
Human molecular genetics 2009 Nov 1;18(21):4022-34
Human molecular genetics 2009 Nov 1;18(21):4022-34
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged LRRK2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol