HPA014293

LRRK2 antibody from Sigma-Aldrich
DKFZp434H2111, FLJ45829, PARK8, RIPK7, ROCO2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014293
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014293, RRID:AB_1853353
Product name
Anti-LRRK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014293
Antibody type
Polyclonal
Antigen
Leucine-rich repeat serine/threonine-protein kinase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKR
LLQLVRENQLQLDENELPHAVHFLNESGVLLHFQD
PALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHP
KGIISRRDVEKFLSKKRKFPKNYMSQYFKLL
Storage
-20C
Provider Type Product Number
- No reagents -