HPA000843

H1-0 antibody from Atlas Antibodies
H1.0, H1F0, H1FV
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000843
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000843, RRID:AB_1079062
Product name
Anti-H1F0
Provider product page
Atlas Antibodies - HPA000843
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MTENSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQK
YIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGV
GASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKK
ASK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -