HPA011215

KSR1 antibody from Sigma-Aldrich
KSR, RSU2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011215
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011215, RRID:AB_1852649
Product name
Anti-KSR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011215
Antibody type
Polyclonal
Antigen
Kinase suppressor of Ras 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SMIFGVKCKHCRLKCHNKCTKEAPACRISFLPLTR
LRRTESVPSDINNPVDRAAEPHFGTLPKALTKKEH
PPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSS
ATTPPNPSPGQRDSRFNFPA
Storage
-20C
Provider Type Product Number
- No reagents -