HPA017160

TAOK3 antibody from Sigma-Aldrich
DPK, JIK, MAP3K18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017160
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017160, RRID:AB_1851994
Product name
Anti-TAOK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017160
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase TAO3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESQEDEEDSEHGTSLNREMDSLGSNHSIPSMSVST
GSQSSSVNSMQEVMDESSSELVMMHDDESTINSSS
SVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQAL
HYRNR
Storage
-20C
Provider Type Product Number
- No reagents -