Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008770 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008770, RRID:AB_2256120
- Product name
- Anti-TMEM176A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MGTADSDEMAPEAPQHTHIDVHIHQESALAKLLLT
CCSALRPRATQAR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Multiomic landscape of immune pathogenesis in Kimura’s disease
Epigenetic silencing of TMEM176A activates ERK signaling in human hepatocellular carcinoma
Wu X, Wang A, Zhang S, Wang X, Guo D, Zhu W, Jiao Y, Zhou J, Zhang W, Peng L, Duan M, Fei Y
iScience 2023;26(4):106559
iScience 2023;26(4):106559
Epigenetic silencing of TMEM176A activates ERK signaling in human hepatocellular carcinoma
Li H, Zhang M, Linghu E, Zhou F, Herman J, Hu L, Guo M
Clinical Epigenetics 2018;10(1)
Clinical Epigenetics 2018;10(1)
No comments: Submit comment
No validations: Submit validation data