HPA008770

TMEM176A antibody from Atlas Antibodies
HCA112, MS4B1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008770
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008770, RRID:AB_1235947
Product name
Anti-TMEM176A
Provider product page
Atlas Antibodies - HPA008770
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MGTADSDEMAPEAPQHTHIDVHIHQESALAKLLLT
CCSALRPRATQAR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -