HPA008770

TMEM176A antibody from Atlas Antibodies
HCA112, MS4B1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008770
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008770, RRID:AB_2256120
Product name
Anti-TMEM176A
Provider product page
Atlas Antibodies - HPA008770
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MGTADSDEMAPEAPQHTHIDVHIHQESALAKLLLT
CCSALRPRATQAR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -