HPA008770

TMEM176A antibody from Sigma-Aldrich
HCA112, MS4B1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008770
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008770, RRID:AB_2256120
Product name
Anti-TMEM176A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008770
Antibody type
Polyclonal
Antigen
Transmembrane protein 176A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGTADSDEMAPEAPQHTHIDVHIHQESALAKLLLT
CCSALRPRATQAR
Storage
-20C
Provider Type Product Number
- No reagents -