Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056603-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056603-M01, RRID:AB_509240
- Product name
- CYP26B1 monoclonal antibody (M01), clone 1H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CYP26B1.
- Antigen sequence
SNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVI
QDTLRAWSSHPEAINVYQEAQKLTFRMAIRVLLGF
SIPEEDLGHLFEVYQQFVDNVFSLPVDLPF- Isotype
- IgG
- Antibody clone number
- 1H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression of a splice variant of CYP26B1 in betel quid-related oral cancer.
Cloning and functional studies of a splice variant of CYP26B1 expressed in vascular cells.
CYP26B1 is a novel candidate gene for betel quid-related oral squamous cell carcinoma.
The involvement of cytochrome p450 (CYP) 26 in the retinoic acid metabolism of human epidermal keratinocytes.
Chen PH, Lee KW, Hsu CC, Chen JY, Wang YH, Chen KK, Wang HM, Huang HW, Huang B
TheScientificWorldJournal 2014;2014:810561
TheScientificWorldJournal 2014;2014:810561
Cloning and functional studies of a splice variant of CYP26B1 expressed in vascular cells.
Elmabsout AA, Kumawat A, Saenz-Méndez P, Krivospitskaya O, Sävenstrand H, Olofsson PS, Eriksson LA, Strid A, Valen G, Törmä H, Sirsjö A
PloS one 2012;7(5):e36839
PloS one 2012;7(5):e36839
CYP26B1 is a novel candidate gene for betel quid-related oral squamous cell carcinoma.
Chen PH, Lee KW, Chen CH, Shieh TY, Ho PS, Wang SJ, Lee CH, Yang SF, Chen MK, Chiang SL, Ko YC
Oral oncology 2011 Jul;47(7):594-600
Oral oncology 2011 Jul;47(7):594-600
The involvement of cytochrome p450 (CYP) 26 in the retinoic acid metabolism of human epidermal keratinocytes.
Pavez Loriè E, Li H, Vahlquist A, Törmä H
Biochimica et biophysica acta 2009 Mar;1791(3):220-8
Biochimica et biophysica acta 2009 Mar;1791(3):220-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CYP26B1 expression in transfected 293T cell line by CYP26B1 monoclonal antibody (M01), clone 1H6.Lane 1: CYP26B1 transfected lysate (Predicted MW: 57.5 KDa).Lane 2: Non-transfected lysate.