HPA012567

CYP26B1 antibody from Sigma-Aldrich
P450RAI-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012567
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012567, RRID:AB_1847429
Product name
Anti-CYP26B1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012567
Antibody type
Polyclonal
Antigen
Cytochrome P450 26B1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SIPEEDLGHLFEVYQQFVDNVFSLPVDLPFSGYRR
GIQARQILQKGLEKAIREKLQCTQGKDYLDALDLL
IESSKEHGKEMTMQELKDGTLELIFAAYATTASAS
TSLIM
Storage
-20C
Provider Type Product Number
- No reagents -