HPA012567

CYP26B1 antibody from Atlas Antibodies
P450RAI-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012567
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012567, RRID:AB_1847429
Product name
Anti-CYP26B1
Provider product page
Atlas Antibodies - HPA012567
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SIPEEDLGHLFEVYQQFVDNVFSLPVDLPFSGYRR
GIQARQILQKGLEKAIREKLQCTQGKDYLDALDLL
IESSKEHGKEMTMQELKDGTLELIFAAYATTASAS
TSLIM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -