HPA009169

SLC7A2 antibody from MilliporeSigma / Merck KGaA
ATRC2, CAT-2, HCAT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009169
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA009169, RRID:AB_1080014
Product name
Anti-SLC7A2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA009169
Antibody type
Polyclonal
Antigen
Low-affinity cationic amino acid transporter 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQAN
DHHPRNLSSPFIFHE
Storage
-20C
Provider Type Product Number
- No reagents -