HPA017605

OR51J1 antibody from Atlas Antibodies
OR51J1P, OR51J2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017605
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017605, RRID:AB_1236280
Product name
Anti-OR51J1
Provider product page
Atlas Antibodies - HPA017605
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GNTEISLEACLFPDVLHPFFIHDGASCAAGHVFGP
LYSHLQPTELHSYPDTAQGLWHRSYYRTEKHYAHG
S
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -