Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007204-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007204-A01, RRID:AB_462463
- Product name
- TRIO polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant TRIO.
- Antigen sequence
ERKSSSLKRRHYVLQELVETERDYVRDLGYVVEGY
MALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFF
LGELEKCLEDPEKLGSLFVKHERRLHMYIAYCQNK
PKSEH- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Upregulated TRIO expression correlates with a malignant phenotype in human hepatocellular carcinoma.
The Rho-guanine nucleotide exchange factor Trio controls leukocyte transendothelial migration by promoting docking structure formation.
Tara up-regulates E-cadherin transcription by binding to the Trio RhoGEF and inhibiting Rac signaling.
Wang B, Fang J, Qu L, Cao Z, Zhou J, Deng B
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine 2015 Sep;36(9):6901-8
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine 2015 Sep;36(9):6901-8
The Rho-guanine nucleotide exchange factor Trio controls leukocyte transendothelial migration by promoting docking structure formation.
van Rijssel J, Kroon J, Hoogenboezem M, van Alphen FP, de Jong RJ, Kostadinova E, Geerts D, Hordijk PL, van Buul JD
Molecular biology of the cell 2012 Aug;23(15):2831-44
Molecular biology of the cell 2012 Aug;23(15):2831-44
Tara up-regulates E-cadherin transcription by binding to the Trio RhoGEF and inhibiting Rac signaling.
Yano T, Yamazaki Y, Adachi M, Okawa K, Fort P, Uji M, Tsukita S, Tsukita S
The Journal of cell biology 2011 Apr 18;193(2):319-32
The Journal of cell biology 2011 Apr 18;193(2):319-32
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TRIO polyclonal antibody (A01), Lot # ABNOVA060705QCS1 Western Blot analysis of TRIO expression in HeLa ( Cat # L013V1 ).