HPA008157

TRIO antibody from Sigma-Aldrich
ARHGEF23
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008157
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008157, RRID:AB_1858327
Product name
Anti-TRIO antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008157
Antibody type
Polyclonal
Antigen
Triple functional domain protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFL
VFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGT
LKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYR
KSREGLSNKVSVKLLNPN
Storage
-20C
Provider Type Product Number
- No reagents -