HPA016936

PITHD1 antibody from Sigma-Aldrich
C1orf128, HT014, TXNL1CL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016936
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016936, RRID:AB_2067141
Product name
Anti-C1orf128 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016936
Antibody type
Polyclonal
Antigen
UPF0424 protein C1orf128 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSKFVESDADEELLFNIPFTGNVKLKGIIIMGEDD
DSHPSEMRLYKNIPQMSFDDTEREPDQTFSLNRDL
TGELEYATKISRFSNVYHLSIHISKNFGADTTKVF
YIGLRGEWTELRRHEVTICNYEASANPA
Storage
-20C
Provider Type Product Number
- No reagents -